Protein Info for CA264_17665 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: molecular chaperone DnaJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 transmembrane" amino acids 121 to 142 (22 residues), see Phobius details PF00226: DnaJ" amino acids 4 to 66 (63 residues), 88 bits, see alignment E=1.2e-28 PF13181: TPR_8" amino acids 217 to 249 (33 residues), 25.7 bits, see alignment 2.9e-09 PF07719: TPR_2" amino acids 217 to 249 (33 residues), 24.8 bits, see alignment 5.6e-09 PF13432: TPR_16" amino acids 221 to 274 (54 residues), 20.6 bits, see alignment 1.9e-07 amino acids 299 to 356 (58 residues), 17.2 bits, see alignment E=2.1e-06

Best Hits

Predicted SEED Role

"Chaperone protein DnaJ" in subsystem Heat shock dnaK gene cluster extended or Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YWI7 at UniProt or InterPro

Protein Sequence (371 amino acids)

>CA264_17665 molecular chaperone DnaJ (Pontibacter actiniarum KMM 6156, DSM 19842)
MNKNYYNVLGISQTASAQEVKAAYKRLAIKYHPDKNPGNVLAEELFKVVNAAYQTLSNPS
KRALYDMRLQYQREQHHRAVMQHQPRRYEERHYRTRQPAGVSERHYKTRQPNNNRFSRKD
WYITLAFVGGILFFSLLLKTVMDHITGEDKYKTALTYIADGKYSSAHRLLTDAIQFMPDK
AAAYEARAMIELDVYENYNSALRDLNKAIALQERPSAQVYYMRGCSYKQLAHYQQAEQDL
TRALKLNKNFWQAHLKRGEVRLFYLKDYKSAIKDFTTFLNHGSASAEQVEALTFRGFGYY
KQGQWARSEQDYRSALALAKGDEDSSGRLYYLLGRTALGQQQPDSACAHFYRAYQQGYTA
AVLELRDRCQP