Protein Info for CA264_17650 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: geranylgeranylglyceryl/heptaprenylglyceryl phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 PF01884: PcrB" amino acids 17 to 234 (218 residues), 125.9 bits, see alignment E=2.6e-40 TIGR01769: phosphoglycerol geranylgeranyltransferase" amino acids 22 to 227 (206 residues), 169 bits, see alignment E=1.2e-53 TIGR01768: geranylgeranylglyceryl phosphate synthase family protein" amino acids 22 to 234 (213 residues), 164.2 bits, see alignment E=3.4e-52 PF00977: His_biosynth" amino acids 178 to 254 (77 residues), 44 bits, see alignment E=2.9e-15 PF01207: Dus" amino acids 183 to 241 (59 residues), 25.4 bits, see alignment E=1.1e-09

Best Hits

Swiss-Prot: 59% identical to GGGPS_SPILD: Geranylgeranylglyceryl phosphate synthase (Slin_5644) from Spirosoma linguale (strain ATCC 33905 / DSM 74 / LMG 10896)

KEGG orthology group: K07094, putative glycerol-1-phosphate prenyltransferase [EC: 2.5.1.-] (inferred from 59% identity to sli:Slin_5644)

MetaCyc: 38% identical to geranylfarnesylglyceryl phosphate synthase (Aeropyrum pernix)
RXN-23119 [EC: 2.5.1.155]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-

Use Curated BLAST to search for 2.5.1.- or 2.5.1.155

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YWE1 at UniProt or InterPro

Protein Sequence (255 amino acids)

>CA264_17650 geranylgeranylglyceryl/heptaprenylglyceryl phosphate synthase (Pontibacter actiniarum KMM 6156, DSM 19842)
MPFNQDRPKSQQHITGRKHFAVLLDPDNLTEASCLNIIALSEQHPVDFFFVGGSLITTQN
QAGIIRLLKEHSQSPVILFPSNSQHIDSQADGILLLSLISGRNPDFLIGQHVISAPALKA
SGLAVYPTGYMLVDTGLQTTASYMSGTTPIPYNKPTIAACTAMAGELLGLQYVYLDGGSG
AQKPVSAEMVAAVREAVELPLIVGGGINTVEKAAETLGAGADVIVIGNHIEKNPGFLAEV
SSLVASYNVALDVRR