Protein Info for CA264_17630 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02199: bifunctional protein RfaE, domain II
  • amino acids 17 to 157 (141 residues), 207.1 bits, E=1e-65
• TIGR00125: cytidyltransferase-like domain
  • amino acids 27 to 79 (53 residues), 54.1 bits, E=1.4e-18
• PF01467: CTP_transf_like
  • amino acids 29 to 153 (125 residues), 62 bits, E=3.6e-21

Best Hits

KEGG orthology group: None (inferred from 64% identity to sli:Slin_3466)

MetaCyc: 52% identical to glycerol-3-phosphate cytidylyltransferase (Aquifex aeolicus)
Glycerol-3-phosphate cytidylyltransferase. [EC: 2.7.7.39]

Predicted SEED Role

"ADP-heptose synthase (EC 2.7.-.-) / D-glycero-beta-D-manno-heptose 7-phosphate kinase" in subsystem LOS core oligosaccharide biosynthesis (EC 2.7.-.-)

MetaCyc Pathways

• ADP-L-glycero-β-D-manno-heptose biosynthesis (5/5 steps found)
• 1-(sn-glycero-3-phospho)-1D-myo-inositol biosynthesis (1/3 steps found)
• lipid A-core biosynthesis (P. gingivalis) (1/7 steps found)
• poly(glycerol phosphate) wall teichoic acid biosynthesis (3/11 steps found)
• poly(3-O-β-D-glucopyranosyl-N-acetylgalactosamine 1-phosphate) wall teichoic acid biosynthesis (2/10 steps found)
• poly(ribitol phosphate) wall teichoic acid biosynthesis I (B. subtilis) (2/12 steps found)
• poly(ribitol phosphate) wall teichoic acid biosynthesis II (S. aureus) (2/14 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism
• Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
• Lipopolysaccharide biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.7.-.-

Use Curated BLAST to search for 2.7.-.- or 2.7.7.39

Sequence Analysis Tools

See A0A1X9YW12 at UniProt or InterPro

Protein Sequence (165 amino acids)

>CA264_17630 D-glycero-beta-D-manno-heptose 1-phosphate adenylyltransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MNSKDKIYSLPQLLEQVQKWRAQGQQIVFTNGCFDLLHLGHVDYLEKARQLGDKLVLGLN
TDASISRIKGPSRPLQDEMSRARVMASLLFIDAVVLFDEDTPLNLIQAVQPDILVKGDDY
AVEQIVGHEVVQARGGAVKTVPLVKGYSTTSIVNKIENNRNLNKS