Protein Info for CA264_17625 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: TIGR00374 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 42 to 60 (19 residues), see Phobius details amino acids 128 to 146 (19 residues), see Phobius details amino acids 167 to 190 (24 residues), see Phobius details amino acids 223 to 247 (25 residues), see Phobius details amino acids 253 to 271 (19 residues), see Phobius details amino acids 277 to 293 (17 residues), see Phobius details amino acids 300 to 325 (26 residues), see Phobius details PF03706: LPG_synthase_TM" amino acids 14 to 317 (304 residues), 155 bits, see alignment E=1.6e-49 TIGR00374: TIGR00374 family protein" amino acids 14 to 321 (308 residues), 46.5 bits, see alignment E=1.7e-16

Best Hits

KEGG orthology group: K07027, (no description) (inferred from 34% identity to bfr:BF0779)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YW10 at UniProt or InterPro

Protein Sequence (348 amino acids)

>CA264_17625 TIGR00374 family protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MKKLFSFLKYALLLGVSAFLMWFALKELDFEKMWAELQNADYGWVMVSVVMGVMAYVSRA
VRWQMQIRPTGYNPPLRNTYNAMMVGYLANLVLPRMGEVVRCSMLRRSDHLPVNTGFGTV
IAERIIDMLMLLLVVGLTFLIEFGRIRDFFLGLFSDKYANLEHSLSSFYWVFWVMLGSVV
VVLFLALRYLSRLRQNTFFRKAVGFVRGMLKGVFSITKLDNQLAFWGHTVFVWLMYYGMS
LVVFYALPATADLGWGAALSVLLVGTLGMAAPVQGGIGVYHLLVQATLLLYGVPKEAGMA
YALLAHTSQTLLVVVMGVLSFMAGMLRRPNRAVVRQSQTNARTHELKR