Protein Info for CA264_17530 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hemolysin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 59 to 86 (28 residues), see Phobius details amino acids 95 to 119 (25 residues), see Phobius details amino acids 131 to 156 (26 residues), see Phobius details PF01595: CNNM" amino acids 9 to 186 (178 residues), 99.8 bits, see alignment E=2.3e-32 PF00571: CBS" amino acids 277 to 330 (54 residues), 25.2 bits, see alignment 2.6e-09 PF03471: CorC_HlyC" amino acids 352 to 423 (72 residues), 76.1 bits, see alignment E=2.7e-25

Best Hits

KEGG orthology group: None (inferred from 52% identity to mtt:Ftrac_2007)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YW43 at UniProt or InterPro

Protein Sequence (433 amino acids)

>CA264_17530 hemolysin (Pontibacter actiniarum KMM 6156, DSM 19842)
MIDPSQIILLLVALLFSAFFSGIEMAFMAANKIQIELSDKNGVLSGRILWHLLQRPARLL
GTALIGNTLALVLYGFAIAGVLHQLLTLYLPEPLQFNLLILVLQISVASVVVLLTAEFLP
RSLFAINPNKMLQVLAVPILLMYYLLWPVVYLIVGLSKWMAEKVFKIEFSEEKPVFGFTD
LNAFIKNRLYHPEQEHAPEVDPQIFHNALEFKTVKVRECMVPRTEVEAVDVESSVEELRE
AFISTGHSKILVYEDSIDNIIGYCHQLAMFKQPQSIKEILSPVSMVPESMLASELFVKFV
SEHRSVAVVVDEFGGTSGIVTVEDVIEEIFGEIQDEYDVNDQLLEQIIPEKGLYILSARH
EIDYLNEKYELGLPEGDYETLGGLIFSEIGEIPTPGDKVEVPPFTITVLTMDENRIDAVK
LLKNADFQADAKS