Protein Info for CA264_17505 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: SMC-Scp complex subunit ScpB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 TIGR00281: segregation and condensation protein B" amino acids 4 to 179 (176 residues), 137 bits, see alignment E=2.8e-44 PF04079: SMC_ScpB" amino acids 7 to 172 (166 residues), 179 bits, see alignment E=2.6e-57

Best Hits

KEGG orthology group: K06024, segregation and condensation protein B (inferred from 60% identity to mtt:Ftrac_2757)

Predicted SEED Role

"Segregation and condensation protein B" in subsystem Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YW69 at UniProt or InterPro

Protein Sequence (187 amino acids)

>CA264_17505 SMC-Scp complex subunit ScpB (Pontibacter actiniarum KMM 6156, DSM 19842)
MDILQNHIQALVFCAQSPISIEEIQRCLQESLGMEEILVSDVLEAVEAINEQLVAQGFAF
QIYAIGGGYQFLTKPEYQDTVSTYLKHKSKKKLSASALETLAIIAYKQPVTRSQMEQIRG
VGCDYAVHKLLEKELIEIKGKADTIGRPVLYGTSQKFMDYFGINHLKDLPQLKDFVTEEN
TIGESAD