Protein Info for CA264_17475 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: DNA replication and repair protein RecF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 TIGR00611: DNA replication and repair protein RecF" amino acids 1 to 364 (364 residues), 294.7 bits, see alignment E=5.1e-92 PF13175: AAA_15" amino acids 1 to 142 (142 residues), 37.2 bits, see alignment E=5.7e-13 PF02463: SMC_N" amino acids 3 to 336 (334 residues), 68 bits, see alignment E=1.7e-22 PF13476: AAA_23" amino acids 11 to 193 (183 residues), 43.4 bits, see alignment E=1.2e-14 PF13304: AAA_21" amino acids 25 to 336 (312 residues), 36.5 bits, see alignment E=1.1e-12

Best Hits

Swiss-Prot: 51% identical to RECF_FLAJ1: DNA replication and repair protein RecF (recF) from Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101)

KEGG orthology group: K03629, DNA replication and repair protein RecF (inferred from 52% identity to shg:Sph21_5257)

Predicted SEED Role

"DNA recombination and repair protein RecF" in subsystem DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YVX4 at UniProt or InterPro

Protein Sequence (370 amino acids)

>CA264_17475 DNA replication and repair protein RecF (Pontibacter actiniarum KMM 6156, DSM 19842)
MLLENISLLFFKNYEEAALSFSEHINCFIGDNGSGKTNLLDAIHYLSMTKSAFPGTDAQS
IKQGEDFFMVKGRFEVGDAKHTVQVSLKQGQKKTVTHNKSPYDKISDHIGRFPVVLISPY
DTDLIREGSEERRKYFDSLISQLDHVYLEQLIQYNYILKQRNSLLKQFAERHYFDRDYLQ
ILNEQLVPFGQQLVQARQRFLQEFVPIFQKHYHHISDSHEEVTLTYKSQLEGHDFAYKLQ
QAERKDTALQRTTVGPHKDDFVFLMDGNPVKSFGSQGQQKSYVIALKLAHFEVMDQRQHH
KPLLLLDDIFDRLDEKRITKLMQMVAAHTFGQIFLTDTHLERTDKILEGLSESIRRFEVK
KGKVKVIGKS