Protein Info for CA264_17395 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: glutathione synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02951: GSH-S_N
  • amino acids 1 to 131 (131 residues), 31 bits, E=4.5e-11
• PF02955: GSH-S_ATP
  • amino acids 136 to 311 (176 residues), 181.3 bits, E=2.3e-57
• PF08443: RimK
  • amino acids 149 to 325 (177 residues), 58.5 bits, E=1.4e-19

Best Hits

KEGG orthology group: K01920, glutathione synthase [EC: 6.3.2.3] (inferred from 61% identity to paa:Paes_0606)

Predicted SEED Role

"Glutathione synthetase (EC 6.3.2.3)" in subsystem Glutathione: Biosynthesis and gamma-glutamyl cycle or Heat shock dnaK gene cluster extended (EC 6.3.2.3)

MetaCyc Pathways

• glutathione biosynthesis (1/2 steps found)
• ophthalmate biosynthesis (1/3 steps found)
• γ-glutamyl cycle (3/6 steps found)

KEGG Metabolic Maps

• Glutathione metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.3

Sequence Analysis Tools

See A0A1X9YW45 at UniProt or InterPro

Protein Sequence (349 amino acids)

>CA264_17395 glutathione synthetase (Pontibacter actiniarum KMM 6156, DSM 19842)
MTIGFVVNDIHTEKASYTTIFLAQRMHNKGHTVYLMGVGDLAYYPDGYMGAEAVQADPKH
KYKSCATYLEALQGDKANKVRVTAPDLDVLMLRNDPSSEGEGRAWAQNAGIIFGQLALRH
DVIVLNDPTKLSDAVNKMYFQHFPEAVRPRTLITRDKEEIKAFFNEQENSIILKPLQGSG
GSGVFMVKKDDATNLNQIVEAISRDGYVIAQEYLPEASEGDVRLFVMNGEALQHKGKYCA
IRRVNSKDDIRSNMHAGGSAQAAKVDQRMLDLVELVKPKLIQDGMFLVGLDIVGDKLMEI
NVFSPGALPDASEMEGVDFSEPVIEALERKVHYKKTYGVQVSNRTVAMI