Protein Info for CA264_17385 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 616 transmembrane" amino acids 44 to 66 (23 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details amino acids 173 to 203 (31 residues), see Phobius details amino acids 274 to 295 (22 residues), see Phobius details amino acids 301 to 319 (19 residues), see Phobius details PF00005: ABC_tran" amino acids 388 to 541 (154 residues), 116.2 bits, see alignment E=1.9e-37

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 67% identity to hhy:Halhy_1445)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YVV7 at UniProt or InterPro

Protein Sequence (616 amino acids)

>CA264_17385 ABC transporter ATP-binding protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MSKAKKGTRDNQTQQEKKSLREQAGALKNLPKFFRMVWDTSPGLTVTNLLLRLVKAALPL
AMLYVGKLIIDEVIRLIDVTGDRSLTYLWTLVALELGLAVLSDLINRGISLVDSLLGDLF
SNRTSVALIEHAAKLDLAQFEDATFYDKLERARRQTVTRVVLMSQVLSQLQDIVTIAFLA
VGLIAFNPWLIGILLIAVIPSFLGETHFNERSYSLSRSWTPERRELDYLRYIGASDETAK
EIKTFNLSGFLAGRFKELSDRYYLLNKGITMKRAFWGSALSALGTLAYYGAYVFILFETV
AGVITVGSLTFLAGSFSNMRSLLQGIMTRFSQIAESALYLQDLFDFLELQPQITPPDNPL
PLPRPIQQGFTFENVGFKYHNSEKWAVRHLSFHLRAGEKMALVGENGAGKTTLVKLLARL
YEPTEGRILLDGVDLREYDLNDLRHQVGIIFQDYVRFQMTASDNIAIGQISNIGNKERIQ
GSAQKSLADLVIQRLPGKYEQVLGKRFNNGVDLSGGEWQKVALARAYMRDAQLLILDEPT
SALDARAEHEVFLRFSELIEGRTAVLISHRFSTVRMADRILFLEQGQLKELGSHEELLAQ
NGKYAELFQLQARGYL