Protein Info for CA264_17380 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: SLC13 family permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 592 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 29 to 46 (18 residues), see Phobius details amino acids 52 to 52 (1 residues), see Phobius details amino acids 56 to 77 (22 residues), see Phobius details amino acids 91 to 117 (27 residues), see Phobius details amino acids 137 to 161 (25 residues), see Phobius details amino acids 174 to 196 (23 residues), see Phobius details amino acids 403 to 435 (33 residues), see Phobius details amino acids 447 to 465 (19 residues), see Phobius details amino acids 485 to 506 (22 residues), see Phobius details amino acids 508 to 520 (13 residues), see Phobius details amino acids 531 to 550 (20 residues), see Phobius details amino acids 570 to 590 (21 residues), see Phobius details PF03600: CitMHS" amino acids 17 to 526 (510 residues), 276.2 bits, see alignment E=5.9e-86 PF02080: TrkA_C" amino acids 311 to 380 (70 residues), 50.9 bits, see alignment E=1.7e-17 PF00939: Na_sulph_symp" amino acids 423 to 588 (166 residues), 60.7 bits, see alignment E=2.1e-20

Best Hits

KEGG orthology group: None (inferred from 45% identity to zpr:ZPR_0525)

Predicted SEED Role

"Sulfate permease, Trk-type" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YW14 at UniProt or InterPro

Protein Sequence (592 amino acids)

>CA264_17380 SLC13 family permease (Pontibacter actiniarum KMM 6156, DSM 19842)
MTVEIAIVLGIIVLAVILFVTERFSIDTVAILIMVLFMLSGILTPAEGLAGFSNPATITV
ASMFIISSAIFKSGMLNGVGLGLTRIGRTNYLLCLLALMLIAGTLSAFINDTAVVALLMP
VVIQVSKDIKVSPSKLLIPLSFGALMGGVCTLIGTSTNILVSGIAQAQGERPLGMFEFAP
AGVWFLLVGVAYMFFIGRHLLPSRKLTESLSEDFDLGDYLTEVVLLPESPSVGVPLQQSS
LVRDLDIEVMQVTRGQEKMQVFPSFILNENDVLKVRIGVEKLKKLKQERGLKLKSERKFR
DEDMSMSDSKLYEAIVTPGSYMEGKSLKELNFRSYNYGASVLAIRHRDEIVHEKPTHVKL
SAGDVLLIAANSSQAEKLRQNEDLLIISQTERSPFNYSKIIPVLLISVGVVLAAATGLVP
IVLSALAGVVLLIIFRCIRVDEVYKAIDWKVIFMLAGVLSMGAALEKTGAARLLADYLIY
GVGEYGPRALLSVFFFITFMTTNFMSNNATAALLAPIAIVTAQELGVSVRPFLMAVAYAA
SLSFMTPMGYQTNTMIYGPGNYRFSDYLKVGTPLNILFWILASLIIPVFFPL