Protein Info for CA264_17355 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: ribonuclease R

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 760 TIGR02063: ribonuclease R" amino acids 62 to 755 (694 residues), 741.3 bits, see alignment E=1.1e-226 TIGR00358: VacB and RNase II family 3'-5' exoribonucleases" amino acids 116 to 754 (639 residues), 536.2 bits, see alignment E=1.1e-164 PF08206: OB_RNB" amino acids 129 to 186 (58 residues), 33.9 bits, see alignment 5.2e-12 amino acids 202 to 256 (55 residues), 31.3 bits, see alignment 3.3e-11 PF17876: CSD2" amino acids 206 to 281 (76 residues), 86 bits, see alignment E=3.6e-28 PF17849: OB_Dis3" amino acids 231 to 274 (44 residues), 27.5 bits, see alignment 6.8e-10 PF00773: RNB" amino acids 303 to 628 (326 residues), 376.6 bits, see alignment E=3e-116 PF00575: S1" amino acids 669 to 751 (83 residues), 33.1 bits, see alignment E=1.5e-11

Best Hits

KEGG orthology group: K12573, ribonuclease R [EC: 3.1.-.-] (inferred from 57% identity to mtt:Ftrac_1053)

Predicted SEED Role

"3'-to-5' exoribonuclease RNase R" in subsystem RNA processing and degradation, bacterial

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YWB6 at UniProt or InterPro

Protein Sequence (760 amino acids)

>CA264_17355 ribonuclease R (Pontibacter actiniarum KMM 6156, DSM 19842)
MRSKKDKKGGRENESRSEKSHSDRGRSRRRGGESSSNRKESAREASARKEPSNRKGAPKS
AKAVVLEVFSNSPDAVFTMRQVTRRLGVTDKAGREQVQNLVKALVRENKLLPVDDDKYMM
NLKVDIITGRVDLANSKYAYIVSEEREEDVRVHTEHLQYAMDGDLVKVEVLPSVRGGRQE
GVVVEVLQRSRSEMVGLMELSKNFGFVVPDFKRTYFDVFVGERHLNDAQSGDKVLVRIIE
WPDKPGKNPTGEVIRVFGPAGEHEAEIHSIMAEFGLPFEFPESVEEEAESISDKIPAGEI
AKRRDFRDVTTFTIDPADAKDFDDALSIQKLENGNWEIGVHIADVTHYVTPRSILEKEAF
HRATSVYLVDRTIPMLPERLSNGLCSLRPNEEKLTFSVVFELDENGKLYDTWYGRTIIYS
DRRFAYEEAQERIETGEGDFAEEINLLNNIAKKLQAKRFKNGAISFETVEVKFKLDENGK
PLSVYVKERKDAHKLIEEYMLLANKKVAEFVYNLSKGKKRPTMVYRTHGSPDPDRLSTFA
LFARKFGYKVDPEGDISEELNHLTKEIEGKPEQSVLQNLAIRTMAKAKYSTEPEGHFGLA
FAHYSHFTSPIRRYPDMMAHRLLQHYLDGGKSADQEEYEERCRHSSEMEKRAADAERASI
KYKQVEFMKDTIGNQYKGIVSGVTEWGIFVEIEENKCEGMVRLADINDDYYELDADNYRI
IGRQTKRIISFGDEVLVEVKSANMADRTIDLDLIETLKQH