Protein Info for CA264_17330 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: lipoprotein signal peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 66 to 86 (21 residues), see Phobius details amino acids 94 to 118 (25 residues), see Phobius details amino acids 163 to 183 (21 residues), see Phobius details PF01252: Peptidase_A8" amino acids 10 to 183 (174 residues), 120.6 bits, see alignment E=3e-39

Best Hits

KEGG orthology group: K03101, signal peptidase II [EC: 3.4.23.36] (inferred from 66% identity to mtt:Ftrac_2466)

Predicted SEED Role

"Lipoprotein signal peptidase (EC 3.4.23.36)" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes or Signal peptidase (EC 3.4.23.36)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.23.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YW04 at UniProt or InterPro

Protein Sequence (207 amino acids)

>CA264_17330 lipoprotein signal peptidase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKYLKYYLAALAVILVDQAVKLIVHYNMEMGMPGEIHLIGDWLKLHYTLNPGMAFGVELG
SDYGKLILTLFRLVAMFGIGYYLYYLASHKAPKGLIWCIALILGGAIGNLVDSTFYGVWF
DNAPYGSSTPWFHGQVVDMFYVDIWEGIVPNWVPILGGKPMSLWPIFNVADSAIFIGVLL
ILFNQKRFFGEHPEPAHQSRMEREKGI