Protein Info for CA264_17320 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 835 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 220 to 238 (19 residues), see Phobius details amino acids 245 to 266 (22 residues), see Phobius details amino acids 272 to 293 (22 residues), see Phobius details amino acids 318 to 341 (24 residues), see Phobius details amino acids 348 to 371 (24 residues), see Phobius details amino acids 404 to 421 (18 residues), see Phobius details amino acids 630 to 649 (20 residues), see Phobius details amino acids 656 to 678 (23 residues), see Phobius details amino acids 684 to 704 (21 residues), see Phobius details amino acids 725 to 748 (24 residues), see Phobius details amino acids 758 to 780 (23 residues), see Phobius details PF03176: MMPL" amino acids 56 to 371 (316 residues), 64.6 bits, see alignment E=1.2e-21 amino acids 605 to 781 (177 residues), 39.1 bits, see alignment E=6.7e-14 PF12349: Sterol-sensing" amino acids 248 to 370 (123 residues), 24.6 bits, see alignment E=3.1e-09

Best Hits

Predicted SEED Role

"Probable integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YVU4 at UniProt or InterPro

Protein Sequence (835 amino acids)

>CA264_17320 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MWNKIAIFIIKNRLRLMLVLAVLTAFMGYHARNVEMSYDFANVVSPDDPDMQYFSRFKQT
FGEDGNVLVVGMQDKSIYQLEKFKQLQELTQQVSKVEGVKGVIALPSLVQVVKDTAERKF
TTQNIFAPFPQTQPRLDSLLQVVENQNFYNGQIINQKTGATLLAITVDPAYLNSARRVEV
MDNIAALTEQFTKDTKIQLHYAGLPYVRAVMTTKVASEMKLFLVLALLVTAVTLFIFFRS
FYAVLIPMLVISVVVVWVMGTISLFGYKISLLTGLIPSIIVVIGIPNTTYLLARYHFDYR
RHGNKVLALTRVISKIGLVNLVNNATTAIGFIVFTFTHIAILYEFGVVAGINIFVTFIIS
MILVPALFSYLPPPTERQLRHLDAKPLNKLLEFFDFIVHRKRPLVYFFLTLILGLSFWGI
YKVKTVSYMVDDLPEESSVNADLAFFEQHFNGVMPLEIIVDTGNKQGVMRLPNLRKLAEL
EGFLHTQPILSAPISVAGLVKTATQAFYEGDPSSYRLPDNTERNFIFSYLAKQNDGANQK
LLRAFVDSTGQSARISLKVADVGSRQLDTLINKRIKPQLREIYGGEGVTVADEGNTMRFT
RDDSGAETTVNLTGTTLLFIKGNQYLINNLRSSLLLAFVLVTFVIALLFKSVRVVVISLI
PNMIPLIIAGGLMGLFNIPLKPSTALIFSIALGIAIDDSIHFLAKYRSELHANGFNVSKA
ITSSLIEAGTSMIYTSLILFFGFVIFAFSEFGGTKALGILMSVSLLIALFTNLIILPTLL
MSFDSGKYIHEPDALIEGYEEYYDEDSDAELDLAQLRLKLDQEEQEPENGKVQRV