Protein Info for CA264_17245 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: malate:quinone oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 504 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 428 to 449 (22 residues), see Phobius details PF06039: Mqo" amino acids 11 to 497 (487 residues), 820.6 bits, see alignment E=6e-251 TIGR01320: malate dehydrogenase (acceptor)" amino acids 12 to 495 (484 residues), 758.9 bits, see alignment E=1.1e-232 PF01266: DAO" amino acids 12 to 281 (270 residues), 46.8 bits, see alignment E=4.9e-16 PF01494: FAD_binding_3" amino acids 169 to 251 (83 residues), 22.2 bits, see alignment E=1.2e-08

Best Hits

Swiss-Prot: 68% identical to MQO_FLAJ1: Probable malate:quinone oxidoreductase (mqo) from Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101)

KEGG orthology group: K00116, malate dehydrogenase (quinone) [EC: 1.1.5.4] (inferred from 69% identity to cpi:Cpin_2378)

MetaCyc: 57% identical to malate:quinone oxidoreductase (Escherichia coli K-12 substr. MG1655)
MALATE-DEHYDROGENASE-ACCEPTOR-RXN [EC: 1.1.5.4]

Predicted SEED Role

"Malate:quinone oxidoreductase (EC 1.1.5.4)" in subsystem TCA Cycle (EC 1.1.5.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.5.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YW15 at UniProt or InterPro

Protein Sequence (504 amino acids)

>CA264_17245 malate:quinone oxidoreductase (Pontibacter actiniarum KMM 6156, DSM 19842)
MRQQDDTENMPDVVLIGAGIMSATLGMMLKELQPNLKLEVFERLDVAAAESSDAWNNAGT
GHSAFCELNYTPETPDGSIDTTKAVRIAESFEISKQFWAYLIQHNIIELPTSFIKNIPHM
SFVWGEDNVNFLRKRYEAMVKCHLFDDMIYSEDREQLKEWVPLIMEGRDASEKVAATRMD
LGTDVNFGALTRSMFKHLQEEAGVKMHFSHEVRKLRQREDGRWRVRVKDLKTGEKRNVYA
RYVFIGAGGGALPLLEKSDIPEGQGYGGFPVSGQWLKCTNREVIERHRAKVYGKAAVGSP
PMSVPHLDTRYINGRRELLFGPYAGFSTKFLKKGSFFDLPKSIKPNNLRPMLSAGIKNLA
LTRYLIDQVRQSPEDRLEALRQYFPDAKAADWELEVAGQRVQIIKKDPEKGGVLEFGTEV
VSGANCTLAALLGASPGASTAVSIMLGLLERCFMERLNTEEWQKKMKEMIPSYGQSLADN
PQLLEKIRGYTSEVLGLVPAVEKK