Protein Info for CA264_17205 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: diacylglycerol kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01219: DAGK_prokar
  • amino acids 13 to 114 (102 residues), 125.2 bits, E=4.5e-41

Best Hits

Swiss-Prot: 37% identical to UDPK_BACSU: Undecaprenol kinase (dgkA) from Bacillus subtilis (strain 168)

KEGG orthology group: K00901, diacylglycerol kinase [EC: 2.7.1.107] (inferred from 48% identity to bhl:Bache_2187)

MetaCyc: 37% identical to undecaprenol kinase (Bacillus subtilis subtilis 168)
Undecaprenol kinase. [EC: 2.7.1.66]

Predicted SEED Role

"Diacylglycerol kinase (EC 2.7.1.107)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.1.107)

MetaCyc Pathways

• diacylglycerol and triacylglycerol biosynthesis (3/7 steps found)
• phosphatidate metabolism, as a signaling molecule (1/5 steps found)
• type I lipoteichoic acid biosynthesis (S. aureus) (4/17 steps found)

KEGG Metabolic Maps

• Glycerolipid metabolism
• Glycerophospholipid metabolism
• Peptidoglycan biosynthesis
• Phosphatidylinositol signaling system

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.107 or 2.7.1.66

Sequence Analysis Tools

See A0A1X9YVU9 at UniProt or InterPro

Protein Sequence (132 amino acids)

>CA264_17205 diacylglycerol kinase (Pontibacter actiniarum KMM 6156, DSM 19842)
MRTYFKKRYNSFKFAFQGLVSAVRSEPHMRLHLLSAVGVAAAGFAFGITKTEWCLVVGCI
GLVVTAEVLNTAIETVVNLVSPEFHPLAGRAKDLAAAAVLIAAIAAAIVGLIVFLPYVLS
FAELYFGAETTV