Protein Info for CA264_17185 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: peptide-methionine (R)-S-oxide reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 132 TIGR00357: methionine-R-sulfoxide reductase" amino acids 11 to 131 (121 residues), 119.8 bits, see alignment E=4.2e-39 PF01641: SelR" amino acids 11 to 125 (115 residues), 150.9 bits, see alignment E=8.1e-49

Best Hits

Swiss-Prot: 60% identical to MSRB5_ORYSJ: Peptide methionine sulfoxide reductase B5 (MSRB5) from Oryza sativa subsp. japonica

KEGG orthology group: K07305, peptide-methionine (R)-S-oxide reductase [EC: 1.8.4.12] (inferred from 78% identity to psn:Pedsa_2432)

Predicted SEED Role

"Peptide methionine sulfoxide reductase MsrB (EC 1.8.4.12) / Peptide methionine sulfoxide reductase MsrA (EC 1.8.4.11)" (EC 1.8.4.11, EC 1.8.4.12)

Isozymes

Compare fitness of predicted isozymes for: 1.8.4.11, 1.8.4.12

Use Curated BLAST to search for 1.8.4.11 or 1.8.4.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YW33 at UniProt or InterPro

Protein Sequence (132 amino acids)

>CA264_17185 peptide-methionine (R)-S-oxide reductase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKIAKAPSEYNKLTPEEARIIVNKGTEYPGTGEYEHNKAEGVYLCRRCNNPLYTSEYKFE
SHCGWPSFDDEITGAVKRVPDADGRRTEIVCANCGGHLGHVFEGEYLTPKNIRHCVNSLS
MKFVPVEQLEKQ