Protein Info for CA264_17175 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: 23S rRNA (adenine(1618)-N(6))-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 PF05971: Methyltransf_10" amino acids 11 to 308 (298 residues), 414.4 bits, see alignment E=2.9e-128 PF05175: MTS" amino acids 114 to 205 (92 residues), 25.3 bits, see alignment E=1.1e-09

Best Hits

Swiss-Prot: 58% identical to RLMF_CYTH3: Ribosomal RNA large subunit methyltransferase F (rlmF) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K06970, ribosomal RNA large subunit methyltransferase F [EC: 2.1.1.181] (inferred from 61% identity to ppn:Palpr_2724)

MetaCyc: 49% identical to 23S rRNA m6A1618 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11596 [EC: 2.1.1.181]

Predicted SEED Role

"Ribosomal RNA large subunit methyltransferase F (EC 2.1.1.51)" (EC 2.1.1.51)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.181 or 2.1.1.51

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YVX7 at UniProt or InterPro

Protein Sequence (330 amino acids)

>CA264_17175 23S rRNA (adenine(1618)-N(6))-methyltransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MPPNKKSHPKEKSGLHPRNRHRARYDFKELVKSCPELRPFVQVNAYNDASVDFFDPKAVK
LLNKALLAHFYGIRNWDIPKGYLCPPIPGRADYIHHVADLLAATHKGQIPKGSRVTGLDV
GVGASCVYPIIGNREYGWSFIGTDIDPVSVQSSRKIVEANTALSGNVELRLQKNPKDVLQ
GVLKPGEQVDFTVCNPPFHASLAEAQAGSVRKLSNLKQQKVAKPTLNFGGQKAELWCEGG
ELRFVRDMVFQSRHLATSCLWFTTLVSKQANIKGILQALKQVKAFEVQTITMSQGNKTSR
LVAWTFQNKAQQEEWAKERWQAEARASEHR