Protein Info for CA264_17080 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: rRNA (cytidine-2'-O-)-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 TIGR00096: 16S rRNA (cytidine(1402)-2'-O)-methyltransferase" amino acids 9 to 228 (220 residues), 264.2 bits, see alignment E=6.7e-83 PF00590: TP_methylase" amino acids 9 to 207 (199 residues), 120.7 bits, see alignment E=4.2e-39

Best Hits

Swiss-Prot: 51% identical to RSMI_HAEIN: Ribosomal RNA small subunit methyltransferase I (rsmI) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K07056, (no description) (inferred from 69% identity to dfe:Dfer_4999)

Predicted SEED Role

"rRNA small subunit methyltransferase I" in subsystem Heat shock dnaK gene cluster extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YW11 at UniProt or InterPro

Protein Sequence (236 amino acids)

>CA264_17080 rRNA (cytidine-2'-O-)-methyltransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MQEQEKTNLYLVPTPIGNLEDITLRAIRVLKEVDVILAEDTRTSGKLLQHLGIEKRMHSH
HLHNEHKATAHLVDRLKAGEVMALISDAGTPGISDPGFYLVRECLKHDLKVECLPGATAF
VPALVKSGFSTDRFTFEGFLPLKKGRQTRLQSLAEEERTMIFYESPHRLLKTLTQFKEYF
GAEREASVSREITKMFEETINGTLEELIEIFNNKAIKGEFVLVVSGAPKGGKADKE