Protein Info for CA264_17045 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: serine hydroxymethyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00464: SHMT
  • amino acids 2 to 392 (391 residues), 555.9 bits, E=2.2e-171

Best Hits

Swiss-Prot: 76% identical to GLYA_CYTH3: Serine hydroxymethyltransferase (glyA) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K00600, glycine hydroxymethyltransferase [EC: 2.1.2.1] (inferred from 76% identity to dfe:Dfer_3814)

Predicted SEED Role

"Serine hydroxymethyltransferase (EC 2.1.2.1)" in subsystem Folate Biosynthesis or Glycine Biosynthesis or Glycine and Serine Utilization or LMPTP YwlE cluster or Photorespiration (oxidative C2 cycle) or Serine-glyoxylate cycle or Serine Biosynthesis (EC 2.1.2.1)

MetaCyc Pathways

• folate transformations III (E. coli) (8/9 steps found)
• superpathway of L-serine and glycine biosynthesis I (4/4 steps found)
• dTMP de novo biosynthesis (mitochondrial) (3/3 steps found)
• glycine degradation (3/3 steps found)
• folate polyglutamylation (4/5 steps found)
• glycine biosynthesis I (1/1 steps found)
• folate transformations II (plants) (8/11 steps found)
• glycine betaine degradation III (4/7 steps found)
• glycine betaine degradation I (4/8 steps found)
• glycine betaine degradation II (mammalian) (1/4 steps found)
• photorespiration II (5/10 steps found)
• folate transformations I (7/13 steps found)
• photorespiration I (4/9 steps found)
• photorespiration III (4/9 steps found)
• formaldehyde assimilation I (serine pathway) (6/13 steps found)
• purine nucleobases degradation II (anaerobic) (13/24 steps found)

KEGG Metabolic Maps

• Cyanoamino acid metabolism
• Glycine, serine and threonine metabolism
• Methane metabolism
• One carbon pool by folate

Isozymes

Compare fitness of predicted isozymes for: 2.1.2.1

Use Curated BLAST to search for 2.1.2.1

Sequence Analysis Tools

See A0A1X9YVP9 at UniProt or InterPro

Protein Sequence (424 amino acids)

>CA264_17045 serine hydroxymethyltransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MQKDTAIFDLIAKEKTRQTHGIELIASENFVSDQVMQAMGSVMTNKYAEGLPGKRYYGGC
EVVDQSEQLAIDRAKELFGVEWVNVQPHSGAQANAAVMLAVLQPGDKILGFDLSHGGHLT
HGSPVNFSGKLYNPSFYGVEQETGLIDFDKVVEAARRERPKLIICGASAYSRDWDYKKLR
QAADEVGALLLADISHPSGLIARGLLNNPFEHCHIVTTTTHKTLRGPRGGMIMMGKDFEN
PFGLKTPKGETRMMSSVLDGAVFPGTQGGPLEHVIAAKAVAYFEALSADYLTYVKQVRQN
AQAMAKAFNDRGYNIISGGTDNHMMLIDLRSKGITGKLAENTLVKADITINKNMVPFDDK
SPFVTSGMRVGTAAITTRGLKEQDMARIVEYIDTVLTNNDNDSKIAAVRSDINNWMQEYP
LFAY