Protein Info for CA264_16995 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 48 to 67 (20 residues), see Phobius details amino acids 74 to 101 (28 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 142 to 164 (23 residues), see Phobius details amino acids 176 to 196 (21 residues), see Phobius details amino acids 207 to 225 (19 residues), see Phobius details PF04240: Caroten_synth" amino acids 59 to 224 (166 residues), 94.7 bits, see alignment E=3.9e-31

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YVN7 at UniProt or InterPro

Protein Sequence (226 amino acids)

>CA264_16995 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MPDTKAALALAPTARKYGRYALPLAVAILVIFHAVGFWGMLFSGRPEYFQRLTPMNLLLT
NALLFAFHRRWNAAFILFAVVVFATGFFAEVLGVHTGLLFGSYAYGEALGAKVWEVPLLI
GLNWLMLVYTTGHISNYTSLPWPVKAVFGAVLMVVLDYFMEPVATVLDFWSWQGGHIPLS
NFLGWFGVALVLHVYFQRAPVYKQNPLAPYVYLVQLLFFVSIFCLL