Protein Info for CA264_16965 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 139 TIGR00149: secondary thiamine-phosphate synthase enzyme" amino acids 13 to 138 (126 residues), 148.4 bits, see alignment E=4.7e-48 PF01894: UPF0047" amino acids 19 to 135 (117 residues), 145.1 bits, see alignment E=5.2e-47

Best Hits

Swiss-Prot: 49% identical to YJBQ_ECOLI: UPF0047 protein YjbQ (yjbQ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 70% identity to pct:PC1_3510)

Predicted SEED Role

"FIG004064: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YVN1 at UniProt or InterPro

Protein Sequence (139 amino acids)

>CA264_16965 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MWFQKEIRLPAVKRGFHLITDLLVAQLPELEGISVGLAHVFIKHTSASLAINEDADPTVR
QDFESHFNHMVPENQPYYRHTLEGSDDMPAHLKAALLGASVTIPIKNGELNMGTWQGIYL
CEHRDHASKRTVVVTLQGQ