Protein Info for CA264_16950 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: 2,3-bisphosphoglycerate-independent phosphoglycerate mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01307: phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
  • amino acids 3 to 506 (504 residues), 667.9 bits, E=4.2e-205
• PF01676: Metalloenzyme
  • amino acids 3 to 495 (493 residues), 263.8 bits, E=2.5e-82
• PF06415: iPGM_N
  • amino acids 81 to 295 (215 residues), 280.1 bits, E=1.7e-87

Best Hits

Swiss-Prot: 66% identical to GPMI_FLAJ1: 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (gpmI) from Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101)

KEGG orthology group: K01834, phosphoglycerate mutase [EC: 5.4.2.1] (inferred from 68% identity to mtt:Ftrac_2141)

Predicted SEED Role

"2,3-bisphosphoglycerate-independent phosphoglycerate mutase (EC 5.4.2.1)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 5.4.2.1)

MetaCyc Pathways

• superpathway of glucose and xylose degradation (16/17 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (22/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (19/22 steps found)
• homolactic fermentation (11/12 steps found)
• glycolysis III (from glucose) (10/11 steps found)
• gluconeogenesis I (11/13 steps found)
• Bifidobacterium shunt (12/15 steps found)
• glycolysis II (from fructose 6-phosphate) (9/11 steps found)
• Rubisco shunt (8/10 steps found)
• glycolysis IV (8/10 steps found)
• glycolysis I (from glucose 6-phosphate) (10/13 steps found)
• Entner-Doudoroff pathway III (semi-phosphorylative) (7/9 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (12/17 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• glycerol degradation to butanol (11/16 steps found)
• superpathway of anaerobic sucrose degradation (13/19 steps found)
• glycolysis VI (from fructose) (7/11 steps found)
• ethene biosynthesis V (engineered) (17/25 steps found)
• glycolysis V (Pyrococcus) (6/10 steps found)
• superpathway of hexitol degradation (bacteria) (11/18 steps found)
• photorespiration II (5/10 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (11/19 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (16/26 steps found)
• superpathway of N-acetylneuraminate degradation (11/22 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (8/18 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (20/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Glycolysis / Gluconeogenesis

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.1

Use Curated BLAST to search for 5.4.2.1

Sequence Analysis Tools

See A0A1X9YVS1 at UniProt or InterPro

Protein Sequence (508 amino acids)

>CA264_16950 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Pontibacter actiniarum KMM 6156, DSM 19842)
MDKKVLLVILDGWGLGTDPEVSAIQKANTPFIDSILEKYPTTTLHASGEYVGLPEGQMGN
SEVGHMNLGAGRVVYQDLVRINKAIAERKLATMPALADAFTYAKENKKPVHFIGLLSDGG
VHSHIDHLKALCTAAYDQELHEVYIHAFTDGRDTDPKGGVKYINELEEHLENTSGTIASI
VGRYYAMDRDNRWERVKLAYDLLVKGEGEKSQNLIKSMLTSYNAGVTDEFIKPIVKVNDN
QEPIATIKNGDVVICFNFRTDRGREITQVLTQRDFPEQDMHKLDLRYITMTTYDETFEGV
QAIFEKDNLNNTLGEVLSKAGKKQIRIAETEKYPHVTFFFSGGRESQFEGESRLLCPSPK
VATYDLQPEMSAYDIRDAIVPELEKKSADFICLNFANPDMVGHTGVFEAAVQACEVVDKC
AEQVITTALESNYDIIVIADHGNADMMINPDGTPNTAHTTNLVPCVLVSNDFKGTLHEGK
LGDIAPTILELMGLQQPEDMNGTSLINH