Protein Info for CA264_16940 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: nicotinate-nucleotide diphosphorylase (carboxylating)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00078: nicotinate-nucleotide diphosphorylase (carboxylating)
  • amino acids 15 to 283 (269 residues), 308 bits, E=2.6e-96
• PF02749: QRPTase_N
  • amino acids 23 to 112 (90 residues), 74.7 bits, E=4.7e-25
• PF01729: QRPTase_C
  • amino acids 114 to 283 (170 residues), 191.7 bits, E=8.3e-61

Best Hits

Swiss-Prot: 47% identical to NADC_ARATH: Nicotinate-nucleotide pyrophosphorylase [carboxylating], chloroplastic (QPT) from Arabidopsis thaliana

KEGG orthology group: K00767, nicotinate-nucleotide pyrophosphorylase (carboxylating) [EC: 2.4.2.19] (inferred from 66% identity to mtt:Ftrac_2356)

MetaCyc: 45% identical to quinolinate phosphoribosyltransferase (decarboxylating) (Nicotiana rustica)
Nicotinate-nucleotide diphosphorylase (carboxylating). [EC: 2.4.2.19]

Predicted SEED Role

"Quinolinate phosphoribosyltransferase [decarboxylating] (EC 2.4.2.19)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.4.2.19)

MetaCyc Pathways

• NAD de novo biosynthesis II (from tryptophan) (9/9 steps found)
• NAD biosynthesis from 2-amino-3-carboxymuconate semialdehyde (4/4 steps found)
• superpathway of NAD biosynthesis in eukaryotes (11/14 steps found)
• NAD de novo biosynthesis I (4/6 steps found)
• NAD de novo biosynthesis III (4/6 steps found)
• NAD de novo biosynthesis IV (anaerobic) (4/6 steps found)
• aspartate superpathway (17/25 steps found)
• nicotine biosynthesis (1/9 steps found)
• superpathway of nicotine biosynthesis (2/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.19

Sequence Analysis Tools

See A0A1X9YVN2 at UniProt or InterPro

Protein Sequence (285 amino acids)

>CA264_16940 nicotinate-nucleotide diphosphorylase (carboxylating) (Pontibacter actiniarum KMM 6156, DSM 19842)
MKPTYLTENSISEFIARALAEDVGDGDHSSLAAIPADAQNQARLLVKGEGILAGVELAGY
IFRAVDPALQLDVLLKDGTAITYGDVAFTVKGKAQSILTAERLVLNCMQRMSGIATYTHY
LASLIEGTGAKLLDTRKTTPNFRIIEKWAVVIGGGQNHRFGLYDMVMLKDNHVDYAGGIR
EAITATQQYLQEKGKSLKIEVETRNLQEVQETLETGGIDRIMLDNMSTDMMREAVRMIGG
KYETEASGGITEETIRAVAECGVDFISVGALTHSNRSIDLSLKAF