Protein Info for CA264_16925 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 PF13489: Methyltransf_23" amino acids 32 to 149 (118 residues), 36.1 bits, see alignment E=2.4e-12 PF01209: Ubie_methyltran" amino acids 37 to 147 (111 residues), 21.2 bits, see alignment E=7.4e-08 PF05175: MTS" amino acids 39 to 147 (109 residues), 26.6 bits, see alignment E=1.9e-09 PF13847: Methyltransf_31" amino acids 47 to 170 (124 residues), 45.9 bits, see alignment E=2.3e-15 PF03848: TehB" amino acids 49 to 155 (107 residues), 50.4 bits, see alignment E=8.6e-17 PF13649: Methyltransf_25" amino acids 51 to 143 (93 residues), 56.4 bits, see alignment E=1.8e-18 PF08241: Methyltransf_11" amino acids 52 to 147 (96 residues), 51.1 bits, see alignment E=8.2e-17 PF08242: Methyltransf_12" amino acids 52 to 145 (94 residues), 33 bits, see alignment E=3.7e-11

Best Hits

KEGG orthology group: None (inferred from 56% identity to psn:Pedsa_2075)

Predicted SEED Role

"methyltransferase, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YW37 at UniProt or InterPro

Protein Sequence (247 amino acids)

>CA264_16925 SAM-dependent methyltransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MAAQQETAEWFSTWFDSPYYHILYRDRDMREAQHFMDNLMAYLHPKPQEKILDLACGKGR
HSLYLNQKGFDVTGIDLSEQSIRYAKQFENERLHFAVHDMREVFRPESFDFVVNLFTSFG
YFDNDTENVVALCSTAKSLKHGGKLVVDFMNTDKVIGSLVAEEEKEVQGINFKITRGVEN
GFIIKTIRFQDNGQEYYFEERVRALRQEDFLEYFKMTQLRMVDTFGDYALRPYDQDSSDR
MIFVLKK