Protein Info for CA264_16920 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: zinc/iron permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 30 to 50 (21 residues), see Phobius details amino acids 63 to 81 (19 residues), see Phobius details amino acids 102 to 120 (19 residues), see Phobius details amino acids 136 to 158 (23 residues), see Phobius details amino acids 169 to 190 (22 residues), see Phobius details amino acids 198 to 220 (23 residues), see Phobius details amino acids 232 to 248 (17 residues), see Phobius details PF02535: Zip" amino acids 2 to 94 (93 residues), 35.4 bits, see alignment E=3.8e-13 amino acids 102 to 242 (141 residues), 45 bits, see alignment E=4.5e-16

Best Hits

KEGG orthology group: None (inferred from 44% identity to mtt:Ftrac_2964)

Predicted SEED Role

"Zinc transporter, ZIP family" in subsystem Transport of Zinc

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YVV9 at UniProt or InterPro

Protein Sequence (249 amino acids)

>CA264_16920 zinc/iron permease (Pontibacter actiniarum KMM 6156, DSM 19842)
MVVAILALFFSVVLSGFLVKVFPPNKTKWLKMALAFSGAYLFTITIIHLLPDVLADSATN
PYRVGYWVLAGFFLQLVLELFSHGVEHGHMHHHHGRTDSMPFLLLGSLFVHAFLEGSILV
ERGHTHGGHAHTADSFYLVLLGVTLHHIPAAFALMSVLMSRLENFRKAFLWLLVFAAGSP
LGILVSNTLLSHEASGGMVYTALTGLVAGNFLHISTTILFESSPDHHFNRNKLVATLLGL
VLALASDFI