Protein Info for CA264_16775 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: metal-dependent hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04199: Cyclase
  • amino acids 21 to 185 (165 residues), 59.1 bits, E=3e-20

Best Hits

KEGG orthology group: K07130, (no description) (inferred from 47% identity to cat:CA2559_04895)

Predicted SEED Role

"N-formylkynurenine (Aryl-) formamidase (EC 3.5.1.9)" (EC 3.5.1.9)

MetaCyc Pathways

• NAD de novo biosynthesis II (from tryptophan) (9/9 steps found)
• L-tryptophan degradation to 2-amino-3-carboxymuconate semialdehyde (5/5 steps found)
• superpathway of NAD biosynthesis in eukaryotes (11/14 steps found)
• L-tryptophan degradation I (via anthranilate) (3/3 steps found)
• 3-hydroxy-4-methyl-anthranilate biosynthesis II (4/5 steps found)
• L-tryptophan degradation III (eukaryotic) (10/15 steps found)
• 3-hydroxy-4-methyl-anthranilate biosynthesis I (3/6 steps found)
• L-tryptophan degradation IX (7/12 steps found)
• L-tryptophan degradation XII (Geobacillus) (6/12 steps found)
• quinoxaline-2-carboxylate biosynthesis (4/10 steps found)
• 3-hydroxyquinaldate biosynthesis (2/8 steps found)
• L-tryptophan degradation XI (mammalian, via kynurenine) (11/23 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (8/35 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (8/42 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Tryptophan metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.9

Sequence Analysis Tools

See A0A1X9YVK2 at UniProt or InterPro

Protein Sequence (256 amino acids)

>CA264_16775 metal-dependent hydrolase (Pontibacter actiniarum KMM 6156, DSM 19842)
MEASITYHNQTYTFNPLEPLDISMPLHQELPQPECFWAEPVSYETIRVGDFVGSVAEGGS
TNYKRVHITPHGNGTHTECYGHISADANATIHNCLKHFLFVAQLITVAPQKQENGDEVVV
LEDVQRQIGAQKPEAVILRTSPNSEEKLTRHYSGTNPPYLDHRIGQYLAQNSIQHLLLDL
PSVDRESDGGELLCHHAFWQYPHSTRCGATITELVYAPDRVADGLYLLNLQIASLQLDAS
PSKPVLYRLSPVYPQL