Protein Info for CA264_16705 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 664 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 50 to 72 (23 residues), see Phobius details amino acids 118 to 140 (23 residues), see Phobius details amino acids 225 to 247 (23 residues), see Phobius details amino acids 321 to 341 (21 residues), see Phobius details PF05569: Peptidase_M56" amino acids 30 to 307 (278 residues), 115.1 bits, see alignment E=3.7e-37 PF01435: Peptidase_M48" amino acids 200 to 242 (43 residues), 24.1 bits, see alignment 2.9e-09

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YVL8 at UniProt or InterPro

Protein Sequence (664 amino acids)

>CA264_16705 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MNRLINLIPGELVNALGWTLLHALWQGAFVALILSVLLVLLHRRSAKTRYAVASAAMLAQ
LVLSAFTLSYYANAPVSTAKAFPAEVPGVTVEATAAAASFWADPVGVSQVYFEQHLPLLV
LLWLLGMVLMAVRLIGGLAYTQRLRHYRTTALGERWQQQLDLLRRRLGVSQAVQLMESAL
VRVPMAIGVAKPVILLPVGAVAGLTQAQVEAVLAHELAHIFRKDYLLNLLQSVVDMLFFF
HPAMWWVSGVVRAERENCCDDIAVALCGDKLTYARALTELETMRMPGASGAALAFSGQRG
SLVNRIKRLVGQPLKPTFTEGFAAGLVLVVGVLVLSFGAVAGQQPLEGTVLEPLEEGSTA
ADTKADSEEAVAFMAQDSAGKNRNVVIITNKKGKVKQLYVDGKRIPKRDIDKYKSLVDQR
LEATKNAPKANRDEVKALIEREQRALDRVERQVREERTVVQSFRGDRLPPLPPMPPVPPV
PPVGAPALAPPPPPAPPAGASKKNKKAFQQLEQLEQLEQYEQQVEQHEQELEQYEQQVEQ
AVRALEQEAAVKRIAQDSLRQKEMKLRQEERATAMRARMEARQEEMQARRAEMEARREEM
EARRRDHAKQMDEMKAEMVKDGLIDSNSSNLNVRINNGELFINDKKQPKKVYDKYKKWMA
PDSK