Protein Info for CA264_16685 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: deoxyguanosinetriphosphate triphosphohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 TIGR01353: putative dGTPase" amino acids 29 to 454 (426 residues), 331.2 bits, see alignment E=6.2e-103 PF01966: HD" amino acids 66 to 133 (68 residues), 24.4 bits, see alignment E=3e-09 PF13286: HD_assoc" amino acids 360 to 452 (93 residues), 23 bits, see alignment E=9.6e-09

Best Hits

Predicted SEED Role

"Deoxyguanosinetriphosphate triphosphohydrolase (EC 3.1.5.1)" in subsystem Purine conversions (EC 3.1.5.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.5.1

Use Curated BLAST to search for 3.1.5.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YYB0 at UniProt or InterPro

Protein Sequence (462 amino acids)

>CA264_16685 deoxyguanosinetriphosphate triphosphohydrolase (Pontibacter actiniarum KMM 6156, DSM 19842)
MASTTWDKLISKKRFEATDKKYTSDESVRGEFQRDYDRIVFSSAFRRLQNKTQVMPMPES
DFVHTRLTHSLEASVVGRSLGRIVGKSILERHQELAEEKNINIQEADFGDVVAAACLAHD
IGNPPFGHSGEDAISAYFQSDEAQPYLQGLTAAEKADLCNYEGNAAGFRVLTYTYPAHCQ
LPDGVSHSGLSLTYTTLATFTKYPKESLPKIADTKSTSEKKYGFFQTEKAWFNTIAQELG
LLKKGKDGEVFYHRHPLAFLVEAADDICYRIIDFEDGLKLGLVPQEQGMHLLRQILNDDP
NRKSSLTFYDWKEEIGYLRARIINKLIEETTAIFLQHEEAILAGNYDKPLINEVSSKPVL
DEIKDLSVRLIYQNRPVLEIEAAGFEVLGGLLDAGIKAVFKPESRHHRKLAALIPPQYLQ
LPESATAYERIIHITDFVASLTDQAALGLYRKIKGIELPRMY