Protein Info for CA264_16680 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 transmembrane" amino acids 72 to 91 (20 residues), see Phobius details amino acids 98 to 117 (20 residues), see Phobius details amino acids 122 to 141 (20 residues), see Phobius details amino acids 148 to 179 (32 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details amino acids 228 to 247 (20 residues), see Phobius details amino acids 258 to 278 (21 residues), see Phobius details amino acids 292 to 314 (23 residues), see Phobius details amino acids 322 to 341 (20 residues), see Phobius details amino acids 353 to 374 (22 residues), see Phobius details

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YVU0 at UniProt or InterPro

Protein Sequence (382 amino acids)

>CA264_16680 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MVAVILFRLNVHGSGYVSPDSQAYLDLAQNIKDGHGFYVPNEGTAGRHYFSAWPVGYPVL
IYLFSQVTSLDVYWASKILNLLFIGAGFLLLRHLCRQYAFVLASVYGAYTYLEVYSFTWS
EAPFLLGLLLLAYVASQVWAGRGTNGHVLVIFLICLSLFLLRYVGAFSFGVPALLGLYWS
YKRKYKVAGKLLVVTTLLALLAAAYLYTNYRLSGFITGFDRLKDETESAGGFVLMLLKGL
FNEFLVIREYRAQNQPDYLLYTTALLQLLLLLYIVVQVRTRYSFWQEAVADRFSAACFGV
AFLYLGAILALRIVSRFDELDYRLLSPFSFPVFIGLLYTLVKLPDASREIVRVKYALFCF
FVLSLLVNVPKNYVVSQLQQLL