Protein Info for CA264_16635 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: AAA family ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 PF20030: bpMoxR" amino acids 12 to 217 (206 residues), 39.8 bits, see alignment E=5.5e-14 PF07726: AAA_3" amino acids 43 to 177 (135 residues), 208 bits, see alignment E=8.4e-66 PF07728: AAA_5" amino acids 45 to 175 (131 residues), 40.3 bits, see alignment E=6.4e-14 PF17863: AAA_lid_2" amino acids 251 to 318 (68 residues), 64.3 bits, see alignment E=1.4e-21

Best Hits

KEGG orthology group: K03924, MoxR-like ATPase [EC: 3.6.3.-] (inferred from 70% identity to zpr:ZPR_1947)

Predicted SEED Role

"FIG017823: ATPase, MoxR family"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YVR2 at UniProt or InterPro

Protein Sequence (331 amino acids)

>CA264_16635 AAA family ATPase (Pontibacter actiniarum KMM 6156, DSM 19842)
MTEQDIHHLLSKLPKLKQEIQKVIVGQEEVLDEVLITLLAGGHGLLEGVPGLAKTLLVRT
LSNAMELGFRRIQFTPDLMPTDILGTEVLEEDHVTGKRFFKFNEGPIFSNIVLADEINRT
PPKTQAALLEAMQEYEVTYAGKTYELPKPFFLLATQNPIEQAGTYPLPEAQLDRFLLYIK
IKYPTEQEELNILANTTGTRQAQVQPSISGEEILQLRQLVREVNISEELLMYVNHIVRAT
RPDSTIVDFVKTYCRWGAGPRAGQALILTAKARALLHGRFAVTEDDIRTMAYPVLRHRVL
VNFTAEAERITPDRVVDELLQSIKLPKAVLV