Protein Info for CA264_16590 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: site-2 protease family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 41 to 61 (21 residues), see Phobius details amino acids 99 to 120 (22 residues), see Phobius details amino acids 140 to 160 (21 residues), see Phobius details amino acids 182 to 202 (21 residues), see Phobius details amino acids 207 to 228 (22 residues), see Phobius details PF02163: Peptidase_M50" amino acids 48 to 125 (78 residues), 58 bits, see alignment E=9.4e-20 amino acids 134 to 194 (61 residues), 34.5 bits, see alignment E=1.4e-12 PF00571: CBS" amino acids 240 to 290 (51 residues), 25.5 bits, see alignment 1.3e-09 amino acids 298 to 351 (54 residues), 21.1 bits, see alignment 3.2e-08

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YVQ0 at UniProt or InterPro

Protein Sequence (359 amino acids)

>CA264_16590 site-2 protease family protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MKWSLNLGRIAGIKILVHWTFALLLGWVAFTEVQRGSDLSATLLAIGFILAVFCCVVLHE
LGHALTARNYGINTKMITLLPIGGVASLEKMPEKPKQELLVALAGPAVNVVIAFLLWLVL
PSLQGMPADDFFLRITADNFLYLLLFVNVVLVLFNAIPAFPMDGGRVLRALLAFKLGRVR
ATQIAANLGQLLAIFFVFIGFFYNPFLILIGAFVFFGAYSENIIVQHLDFLRGHSVREGM
MTNYVTLAPTDTVREAVGKLLMGSEHEFIIEEEGRVTGTLTRSQLIQAVKDEQMETPVAR
VMSSEVRTFNVQDKLSEAYTELQKSRAPLYPVLENGRLAGVINTDNINEFIMIKSALMH