Protein Info for CA264_16580 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: aminoacyl-tRNA hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 136 PF00472: RF-1" amino acids 9 to 130 (122 residues), 71 bits, see alignment E=4.1e-24

Best Hits

KEGG orthology group: K15034, ribosome-associated protein (inferred from 55% identity to cly:Celly_1177)

Predicted SEED Role

"Hypothetical protein YaeJ with similarity to translation release factor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YVR6 at UniProt or InterPro

Protein Sequence (136 amino acids)

>CA264_16580 aminoacyl-tRNA hydrolase (Pontibacter actiniarum KMM 6156, DSM 19842)
MNLRNRGLEQELQFQASRSGGAGGQNVNKVNTKVELRFHVQHSALLTDEEKELVQEKLSN
RINNEGYLQVVCQTERSQLKNKELCMQRFFELLRQALTKQKKRTATRPTRSSVRRRLEGK
KKQAEKKANRGFRGDF