Protein Info for CA264_16520 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: DNA-binding response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 PF00072: Response_reg" amino acids 4 to 110 (107 residues), 100.7 bits, see alignment E=1.7e-32 PF14532: Sigma54_activ_2" amino acids 141 to 310 (170 residues), 75.3 bits, see alignment E=1.7e-24 PF00158: Sigma54_activat" amino acids 141 to 305 (165 residues), 228.9 bits, see alignment E=9.2e-72 PF07728: AAA_5" amino acids 163 to 281 (119 residues), 33.1 bits, see alignment E=1.6e-11 PF00004: AAA" amino acids 164 to 281 (118 residues), 21.6 bits, see alignment E=7.6e-08 PF02954: HTH_8" amino acids 413 to 451 (39 residues), 47.1 bits, see alignment 4.6e-16

Best Hits

Swiss-Prot: 40% identical to LUXO_VIBVY: Regulatory protein LuxO (luxO) from Vibrio vulnificus (strain YJ016)

KEGG orthology group: K07713, two-component system, NtrC family, response regulator HydG (inferred from 55% identity to osp:Odosp_2817)

Predicted SEED Role

"Response regulator of zinc sigma-54-dependent two-component system" in subsystem Zinc resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YVK7 at UniProt or InterPro

Protein Sequence (456 amino acids)

>CA264_16520 DNA-binding response regulator (Pontibacter actiniarum KMM 6156, DSM 19842)
MPKILLIDDDPAFCLMLKGYLKRQQYEVETAYTANDGLRVLKASSFDLILTDFRLPDKDG
LELLSQIRVLTQEVPVILMTTYADIRTAVRAIKMGAFEYITKPINPDETLLVIKNALNRK
AEAEQEAVSTASAGSFQFVRGQSPQAEQIEEFISLVAPTNLSVIIEGESGTGKEYVARMI
HEQSKRHDRPFVAIDCGALSKELAGSELFGYVKGAFTGALQDKRGQFEAAEGGTLFLDEI
GNLPYEVQVKLLRALQERKVRKLGSTTDQNVDVRVLAATNEDLVQAVANGQFREDLYHRL
NEFKINLPPLRDRDGDVVLFANHFLQQANRELEKAVQGFDAATEDAMLRYNWPGNLRELK
NVVKRAVLLAKSEFVTLQELPAEIVHYTPAPQQASVAYSPHDPMETDLKSINERTEREMI
LAMLERVKYNKSKAARLLNIDRKTLYNKLKLYNIEI