Protein Info for CA264_16405 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: YraN family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 120 TIGR00252: TIGR00252 family protein" amino acids 10 to 119 (110 residues), 73.6 bits, see alignment E=6.7e-25 PF08378: NERD" amino acids 12 to 67 (56 residues), 24 bits, see alignment E=7.2e-09 PF02021: UPF0102" amino acids 15 to 104 (90 residues), 98.4 bits, see alignment E=3.9e-32 PF01870: Hjc" amino acids 20 to 74 (55 residues), 21.2 bits, see alignment E=3.5e-08

Best Hits

Swiss-Prot: 45% identical to Y3098_GRAFK: UPF0102 protein GFO_3098 (GFO_3098) from Gramella forsetii (strain KT0803)

KEGG orthology group: K07460, putative endonuclease (inferred from 54% identity to sli:Slin_5877)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YVD0 at UniProt or InterPro

Protein Sequence (120 amino acids)

>CA264_16405 YraN family protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MASQISTHLRTGQLGENHAATYLRKQGYTVLRQNYRYKRAEVDIIAQKGNLLVFAEVKTR
ATNKYGYPEEAVNAKKEEMLLSAAEAYILQQEWQHEVRFDIIAVTLSSPPAIHHIEDAFH