Protein Info for CA264_16225 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: TonB-dependent siderophore receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 809 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF13620: CarboxypepD_reg" amino acids 26 to 101 (76 residues), 58.5 bits, see alignment E=1.4e-19 PF13715: CarbopepD_reg_2" amino acids 27 to 113 (87 residues), 69.4 bits, see alignment E=4.2e-23 PF07715: Plug" amino acids 135 to 230 (96 residues), 57.3 bits, see alignment E=4.1e-19 TIGR01783: TonB-dependent siderophore receptor" amino acids 139 to 809 (671 residues), 262.9 bits, see alignment E=3.5e-82 PF00593: TonB_dep_Rec" amino acids 312 to 779 (468 residues), 140.9 bits, see alignment E=2.3e-44

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 46% identity to bfr:BF0019)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YVR0 at UniProt or InterPro

Protein Sequence (809 amino acids)

>CA264_16225 TonB-dependent siderophore receptor (Pontibacter actiniarum KMM 6156, DSM 19842)
MFKKFTLVCLCMLLTQLAWAQHRGSSIRGQVLQGNGQPLAAASIVVENTPFGTVTDENGF
FKILHMPEGNYQVRAMMIGFNSVTEKVQLGKGETKSVSFSLAAKANQVSEIEVFGVRDKQ
PEKLDAITRLPLKPSEQIQSISVISEKLIEQQGALTVIEGVRNVPGVYTYATYGGVRESI
SSRGFRGIPTLKNGVRVMTDFRGIGFSTDMQGVESVQVLKGASAITMGASTDLGGPGGIV
NIVTKTPKFENSGVVSLRAGSWGLIRPTFDVQRVVDKDNKLAVRLNGAYENGGKFRDHMD
NESFYINPSLEWRPNAKSTLTLEMDYFKEEQAIDAGTVNLSVGNKKNEIYDLPADRFLGF
ESDKTDITHTTYAARYKYNLNSSLYLRAAFFNSNYNADGIRTSLSALKGKNVNQEQVNIY
SRSIAHNQAREDNSTVMQVDLVGQKIKTGGINHTFQIGTDYRYIDLYTPAYNAIGIDTID
VLNPETITNTLPAGVGAFTRTGGTQSYDHSFGVTLQDVIQLTDWARVYGGVRYSTNKSKS
AGEASATSEFWNPLAGVMFTVKDGLNIFGSYTNSTNPRSAAVVDVNGDALGAERIDQFEA
GIKSEWLNDRLRFNLTFYKINNKDMNLKAFTVDDLGNVLETGYYIKGGNDERKGIEVELT
GRVLENLEVVAGYAYIDAQYKEHTTFVTGSAPNNTPKHTFNAYANYTLQTGVLRGLNLGA
GAYYLGERPYNDWTLPGVQYHNIDPNTAPWDNKAYTIVNAQIGYEFQQHWGVRALFNNIF
DEVGYDAYRSNFIDRIQPRNFSGVVTYRF