Protein Info for CA264_16220 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: sulfite reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 transmembrane" amino acids 16 to 38 (23 residues), see Phobius details amino acids 186 to 207 (22 residues), see Phobius details amino acids 237 to 259 (23 residues), see Phobius details amino acids 384 to 405 (22 residues), see Phobius details PF03929: PepSY_TM" amino acids 14 to 407 (394 residues), 234 bits, see alignment E=1.7e-73

Best Hits

Predicted SEED Role

"putative iron-regulated membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YVH6 at UniProt or InterPro

Protein Sequence (427 amino acids)

>CA264_16220 sulfite reductase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKKGYSLRKFFNDVHLWLGIASGLVLFVVCLSGTVYTFRTEIEEALEPDKYEVAVPANAK
PFSPDALVFKVEKELKGKVVSLEIPQDKALAYRVGVAKKPEGGGERAGKGPEAAAAQKSE
AKGGKEGKKEGKGGHGPGGGGRPTTYMVNPYTGAVLGTTEGPASEFFLKVMQLHRWLLIE
GGTGKMIVGVSTIIFTILVLTGLVLWWPKKIKNWKQGFKVKTDANWKRINHDLHNTLGFY
AFILLLIMSLTGLCWSFEWYRDGLSSIMGDEVFKGRREKPLSAEATGEASSLQLADYLAK
ANAILPYEGNTRISIPSDDTTAVVVTKSEAGFFALSASDKVQLNQHNGEALQVEVFADKP
LNEQIVALIRPLHLGDVYGTFSKILYFISCLIATSLPVTGTLIWINKLRKKKPGKRVPRN
AATQVAG