Protein Info for CA264_15945 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: NAD-dependent epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 PF04321: RmlD_sub_bind" amino acids 7 to 164 (158 residues), 44.1 bits, see alignment E=4.5e-15 PF02719: Polysacc_synt_2" amino acids 8 to 117 (110 residues), 23.3 bits, see alignment E=1.1e-08 PF01370: Epimerase" amino acids 8 to 239 (232 residues), 101.7 bits, see alignment E=1.4e-32 PF01073: 3Beta_HSD" amino acids 9 to 155 (147 residues), 28.9 bits, see alignment E=1.8e-10 PF16363: GDP_Man_Dehyd" amino acids 9 to 173 (165 residues), 58.7 bits, see alignment E=2.1e-19 PF07993: NAD_binding_4" amino acids 72 to 211 (140 residues), 23.2 bits, see alignment E=1.1e-08

Best Hits

Swiss-Prot: 50% identical to Y2164_STAS1: Uncharacterized epimerase/dehydratase SSP2164 (SSP2164) from Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

KEGG orthology group: None (inferred from 63% identity to mtt:Ftrac_2956)

Predicted SEED Role

"L-threonine 3-dehydrogenase (EC 1.1.1.103)" in subsystem Glycine Biosynthesis or Threonine degradation (EC 1.1.1.103)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.103

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YVC6 at UniProt or InterPro

Protein Sequence (324 amino acids)

>CA264_15945 NAD-dependent epimerase (Pontibacter actiniarum KMM 6156, DSM 19842)
MANTSDTVLVIGACGQLGSELTMELRQMYGEANVVAADIAPPKQAELRESGPFEKVDVLD
TKVLAELASKYKFKQIYHLAAVLSATGEKNPKFAWKLNMDGLFNVLDLALEQKTGRVYWP
SSIACFGPSTPRQNTPQQTIMDPNTVYGISKQAGERWCEYYFQKYGLDVRSLRYPGLIGY
KALPGGGTTDYAVDIYHKALEGEAFECFLSEDTYLPMMYMPDALKATLDLMHAPAEQIKV
RDSYNLSAMSFSPKEVAAAIRKHISDFEIVYKPDSRQQIANSWPQSIDDSAAQQDWGWSP
NYNLDAMTEDMLLNLRKMKQEQAV