Protein Info for CA264_15910 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 TIGR00048: 23S rRNA (adenine(2503)-C(2))-methyltransferase" amino acids 12 to 355 (344 residues), 397.8 bits, see alignment E=2e-123 PF21016: RlmN_N" amino acids 15 to 72 (58 residues), 66.2 bits, see alignment E=1.7e-22 PF04055: Radical_SAM" amino acids 116 to 288 (173 residues), 54.5 bits, see alignment E=1.6e-18

Best Hits

Swiss-Prot: 64% identical to RLMN_CYTH3: Probable dual-specificity RNA methyltransferase RlmN (rlmN) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K06941, ribosomal RNA large subunit methyltransferase N [EC: 2.1.1.-] (inferred from 68% identity to dfe:Dfer_4731)

Predicted SEED Role

"Ribosomal RNA large subunit methyltransferase N (EC 2.1.1.-)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YV43 at UniProt or InterPro

Protein Sequence (357 amino acids)

>CA264_15910 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN (Pontibacter actiniarum KMM 6156, DSM 19842)
MTLIADLNILNKKDIRKLTLDDLKAWFVEQGEKPFRAKQVYEWLWKHSAQSFTEMNNVSL
ALREKLDQHFSINSVQVATEQLSNDGTIKSAFKLHDSHIVEGVLIPHDERKTACVSSQVG
CSLTCKFCATGYMDRVRNLDAAEIYDQVVRINEQSLRQYGQPLTNIVYMGMGEPMLNYAN
VMKSIERITAHDGLGMAARRITVSTAGIAKLIKKMADDGVKANLALSLHAANDEKRNQIM
PINETNSLEALKDALKHYHQVTGRKVTYEYIVFDNFNDTLQDAEELLRFSKIIPCKINLI
EYNPIENADFVNTDDDRLQAFIYYLADRGLQVNVRRSRGKDIDAACGQLAVKEKQPA