Protein Info for CA264_15880 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: 5-formyltetrahydrofolate cyclo-ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01812: 5-FTHF_cyc-lig
  • amino acids 3 to 184 (182 residues), 122.5 bits, E=1e-39
• TIGR02727: 5-formyltetrahydrofolate cyclo-ligase
  • amino acids 3 to 183 (181 residues), 143.4 bits, E=3.7e-46

Best Hits

KEGG orthology group: K01934, 5-formyltetrahydrofolate cyclo-ligase [EC: 6.3.3.2] (inferred from 41% identity to dfe:Dfer_3731)

Predicted SEED Role

"5-formyltetrahydrofolate cyclo-ligase (EC 6.3.3.2)" in subsystem Folate Biosynthesis or One-carbon metabolism by tetrahydropterines or Serine-glyoxylate cycle (EC 6.3.3.2)

MetaCyc Pathways

• folate transformations III (E. coli) (8/9 steps found)
• folate transformations II (plants) (8/11 steps found)
• folate transformations I (7/13 steps found)

KEGG Metabolic Maps

• One carbon pool by folate

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.3.2

Sequence Analysis Tools

See A0A1X9YV39 at UniProt or InterPro

Protein Sequence (192 amino acids)

>CA264_15880 5-formyltetrahydrofolate cyclo-ligase (Pontibacter actiniarum KMM 6156, DSM 19842)
MRKADLRKQMLQQRRALPQEEVQRRSQGIAEQFFRHFPLQAGQTVHVFLPIIKNNEVNTW
PIIEQLRLEHPEVRVVVPVTDVEQHVLTHHHLTDEAILVENRWGIPEPQNAQIIHAREVD
VVLIPLLAFDRAGQRVGYGKGFYDRFLADCRPDVLKIGLSLEPPVARIADPNPFDVPLDA
VVMPEGVWHKPL