Protein Info for CA264_15875 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: bacillithiol biosynthesis cysteine-adding enzyme BshC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 525 transmembrane" amino acids 329 to 347 (19 residues), see Phobius details amino acids 353 to 372 (20 residues), see Phobius details PF10079: BshC" amino acids 6 to 521 (516 residues), 613.1 bits, see alignment E=2.5e-188 TIGR03998: bacillithiol biosynthesis cysteine-adding enzyme BshC" amino acids 19 to 521 (503 residues), 448.4 bits, see alignment E=2.1e-138

Best Hits

Swiss-Prot: 41% identical to BSHC_CYTH3: Putative cysteine ligase BshC (bshC) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: None (inferred from 48% identity to lby:Lbys_2704)

Predicted SEED Role

"FIG00907876: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YYE4 at UniProt or InterPro

Protein Sequence (525 amino acids)

>CA264_15875 bacillithiol biosynthesis cysteine-adding enzyme BshC (Pontibacter actiniarum KMM 6156, DSM 19842)
MEVQTMKITKIDYAATGAFSQTITDYLCRGEQLRPFYNHFPTVEAFEAQLKEKSFSEAQR
QTLHQALQEQYTSIAEVNPNVQQNIDLLQQSNTFTITTGHQLNIFTGPLYFIYKIITAIN
TCKQLQEKYPDYNFVPVYWMATEDHDFAEINHFNLFGKKYTWESEQTGAVGRFSTKDMEQ
LLAELPEAYPIFEEAYRNSKNLADATRAITHELFGAYGLVSIDGDHAGLKKALLPVIEKE
LTEQLSNKLVEEASAQLEELGYKPQVYSREINLFYLTDGLRERIVQEEDKYKVLNTDLSF
TLEEIQQEAQEHPERFSPNVILRPLFEELILPNLAYIGGGAEVAYWFQLKKLFAAYKVAF
PLLMLRNSALYISRSNANRMHKLDLQPQDLFQDYQELKKQLSAQIHEEDIDLTAQREAVA
AAFAEVEKLAKEIDPTLEKAVGAEEQKAHNALQMLEKKISKARDNKHEQTFKQLENLKDK
LFPGGTLQERKDNLLTYKTNNPDFIPALIEAFDPLEFKFTILEEE