Protein Info for CA264_15775 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: type III polyketide synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00195: Chal_sti_synt_N
  • amino acids 3 to 217 (215 residues), 116.8 bits, E=2.6e-37
• PF08392: FAE1_CUT1_RppA
  • amino acids 113 to 219 (107 residues), 43.7 bits, E=5.7e-15
• PF08545: ACP_syn_III
  • amino acids 154 to 225 (72 residues), 26.2 bits, E=1.5e-09
• PF02797: Chal_sti_synt_C
  • amino acids 225 to 365 (141 residues), 84.8 bits, E=1.7e-27
• PF08541: ACP_syn_III_C
  • amino acids 277 to 365 (89 residues), 47.8 bits, E=3.4e-16

Best Hits

KEGG orthology group: K00660, chalcone synthase [EC: 2.3.1.74] (inferred from 55% identity to sli:Slin_2532)

Predicted SEED Role

"Chalcone synthase (EC 2.3.1.74)" in subsystem Flavanone biosynthesis (EC 2.3.1.74)

MetaCyc Pathways

• aromatic polyketides biosynthesis (1/2 steps found)
• phloridzin biosynthesis (1/3 steps found)
• naringenin biosynthesis (engineered) (1/4 steps found)
• xanthohumol biosynthesis (1/4 steps found)
• flavonoid biosynthesis (1/5 steps found)
• flavonoid biosynthesis (in equisetum) (1/10 steps found)
• flavonoid di-C-glucosylation (4/15 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Flavonoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.74

Sequence Analysis Tools

See A0A1X9YVB4 at UniProt or InterPro

Protein Sequence (375 amino acids)

>CA264_15775 type III polyketide synthase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKSYICAIGTANPPHKIPQMQVADFMATALQFDEQDTRKLKALYRVSGIGQRYSVLEDYT
RQNGDFSFYPNTPTLEPFPTVQQRMSVYRKHAVDLSEAAIRNCLKLASPSQLGDLTHLIT
VSCTGMYAPGLDIELVERLGLSPCVQRTAVNFMGCYAAFNAIKLADSICRANPEAKVMLV
CTEICTIHFQKHAEQDHLVSNALFGDGAAAVLMQGQPCEQVSLELQSFHCDLAPAGKREM
AWHIGDTGFEMTLSSYVPDLIKKGIKQLTERLLQGLKTTVSEIKLFAIHPGGRRILEVIE
QELGMTREDNRFAYQVLREFGNMSSATVLFVLKELMQTLTPQEQDEPVLSFAFGPGLTLE
SMLLKVHYADAKAAV