Protein Info for CA264_15740 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: metal-dependent phosphohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 transmembrane" amino acids 255 to 274 (20 residues), see Phobius details amino acids 289 to 311 (23 residues), see Phobius details amino acids 387 to 408 (22 residues), see Phobius details PF01966: HD" amino acids 42 to 137 (96 residues), 24.2 bits, see alignment E=3.4e-09 PF18967: PycTM" amino acids 287 to 395 (109 residues), 100.6 bits, see alignment E=6.8e-33

Best Hits

Predicted SEED Role

"Metal-dependent phosphohydrolase, HD subdomain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YV37 at UniProt or InterPro

Protein Sequence (410 amino acids)

>CA264_15740 metal-dependent phosphohydrolase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKDQTIARQAGEEDQAIVKQAGEHVFRLFKQNLSKKLVYHNYKHTFETVAEAQELGQLSR
LPEDRLLDLVLAAWFHDTGYIATYEGHEQESVRIATEWLEEKEFSQERIDHITGIILATQ
HKQDPETLEQELMVDADMSNIGKDTFFATAELLRVEWEIFQDKFFSDDEWEQFQMDFLLS
TTFHTIQAQRKFAAQLGLNIQEQRSRLNKEIKKKKKEEKKHRKTLAQPKRGIETMFRNTY
RTHLNLSAIADNKANMMISLNAIIISVIITYLSAKTSTIGADYTTHRTFLIPIGILLLTT
LGSVVFAIISAQPEVTSFTFKKKKNKKLDTRKVNLLFFGNFTNLPLEEFQSGMHDIMRDK
KSLYNNMITDIYYLGDVLNRKYKILRISYTIFMVGLVLTVVGFAVAVASY