Protein Info for CA264_15720 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: phosphohistidine phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00300: His_Phos_1
  • amino acids 4 to 72 (69 residues), 38.6 bits, E=4.8e-14

Best Hits

KEGG orthology group: K08296, phosphohistidine phosphatase [EC: 3.1.3.-] (inferred from 44% identity to sku:Sulku_1674)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Ether lipid metabolism
• Fructose and mannose metabolism
• Lipopolysaccharide biosynthesis
• Nicotinate and nicotinamide metabolism
• Riboflavin metabolism
• Sphingolipid metabolism
• Thiamine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.-

Use Curated BLAST to search for 3.1.3.-

Sequence Analysis Tools

See A0A1X9YV91 at UniProt or InterPro

Protein Sequence (164 amino acids)

>CA264_15720 phosphohistidine phosphatase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKTLYILRHAKSSWEFDELSDHDRPLNKRGRHDAPLMGQELASRGVEPGLIISSPAVRAI
STATLVGKELDYDADDIVVDTRVYGANEEDLLEVVQSAPAEIGTLLLVGHNEAVSDFANL
LSPEPVPSMATTGVTGLQFNCDSWYDIAKDNAKLLFYDFPKNHR