Protein Info for CA264_15715 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: GTPase HflX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 TIGR03156: GTP-binding protein HflX" amino acids 16 to 382 (367 residues), 425.6 bits, see alignment E=1.4e-131 PF13167: GTP-bdg_N" amino acids 32 to 120 (89 residues), 120 bits, see alignment E=2.2e-38 PF16360: GTP-bdg_M" amino acids 122 to 200 (79 residues), 101.6 bits, see alignment E=1.1e-32 PF00025: Arf" amino acids 203 to 339 (137 residues), 27.5 bits, see alignment E=8.5e-10 TIGR00231: small GTP-binding protein domain" amino acids 204 to 341 (138 residues), 48.7 bits, see alignment E=7.4e-17 PF02421: FeoB_N" amino acids 205 to 341 (137 residues), 28.8 bits, see alignment E=3.2e-10 PF01926: MMR_HSR1" amino acids 205 to 323 (119 residues), 80.3 bits, see alignment E=4.6e-26 PF00071: Ras" amino acids 206 to 382 (177 residues), 28.1 bits, see alignment E=5.5e-10 PF04670: Gtr1_RagA" amino acids 206 to 341 (136 residues), 25.4 bits, see alignment E=3.6e-09

Best Hits

Swiss-Prot: 58% identical to HFLX_FLAPJ: GTPase HflX (hflX) from Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511)

KEGG orthology group: K03665, GTP-binding protein HflX (inferred from 64% identity to shg:Sph21_1159)

Predicted SEED Role

"GTP-binding protein HflX" in subsystem Hfl operon or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YVA4 at UniProt or InterPro

Protein Sequence (395 amino acids)

>CA264_15715 GTPase HflX (Pontibacter actiniarum KMM 6156, DSM 19842)
MAKQKFYETSKPQETAVLVAVPHYRQTEEQTEEYLDELAFLAETAGAQTLKRFVQKLDKP
DVRTFVGSGKLDEIQAYVKEHEVDMVIFDDDLSPSQVRNIERELQVKIVDRSLLILDIFA
LRAKTAQAHAQVEMAQYQYLLPRLTNLWTHLSKQKGGIGMKGPGETEIETDRRIVRDKIS
LLRERLQKFEKQNFEQRKARAGIVRVALVGYTNVGKSTLMNLLSKSEVFAENKLFATVDA
TVRKVVLDNVPFLLSDTVGFIRKLPTKLIESFKSTLDEIREADMLVHVVDISHPSFEDHI
AVVNETLKDINSADKPVLLVFNKIDLYLERRQQELQEEDMAARPSLEDLKATYMAKEHAP
AMFISATDRMNIDALREELQRRVAEIHYQRYPNNV