Protein Info for CA264_15645 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: ornithine--oxo-acid transaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 TIGR01885: ornithine--oxo-acid transaminase" amino acids 9 to 410 (402 residues), 666.4 bits, see alignment E=6.4e-205 PF00202: Aminotran_3" amino acids 19 to 410 (392 residues), 414 bits, see alignment E=2.9e-128

Best Hits

Swiss-Prot: 62% identical to OAT_HUMAN: Ornithine aminotransferase, mitochondrial (OAT) from Homo sapiens

KEGG orthology group: K00819, ornithine--oxo-acid transaminase [EC: 2.6.1.13] (inferred from 72% identity to chu:CHU_0647)

MetaCyc: 62% identical to Ornithine aminotransferase (Homo sapiens)
Ornithine aminotransferase. [EC: 2.6.1.13]

Predicted SEED Role

"Ornithine aminotransferase (EC 2.6.1.13)" in subsystem Arginine and Ornithine Degradation or Dimethylarginine metabolism (EC 2.6.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YUZ9 at UniProt or InterPro

Protein Sequence (413 amino acids)

>CA264_15645 ornithine--oxo-acid transaminase (Pontibacter actiniarum KMM 6156, DSM 19842)
MSTQTINSSQEAIDIEHQYGAHNYHPLPVVLSRGEGVHLWDVEGKHYYDFLSAYSAVNQG
HCHPKIVGALVEQAQQLTLTSRAFYNDKLGPAEKYICEYFNYDKALFMNSGAEAVETAIK
LARKWGYMKKGIAPHNAEIIVVEHNFHGRTTGIISFSTDPDSTKGFGPYMPGYKVIPYND
ADALEQALKENPNVCGFLVEPIQGEAGVMVPDEGYLAKAHALCKEYDVLLMADEIQTGIG
RTGKLLASYYDDVKADILILGKALSGGVLPVSCVLANDDIMLCIQPGEHGSTFGGNPLAA
VVAIAALEVIKEESLTENANRLGELFRERMRRLMDKRPELVTLVRGRGLLNAIVVQPTAD
GRTAWDVCVELKNHGLLAKPTHGDIIRFAPPLVMTEEQLNECCDIIENVILSF