Protein Info for CA264_15630 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: haloacid dehalogenase, type II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01428: haloacid dehalogenase, type II
  • amino acids 14 to 205 (192 residues), 173.2 bits, E=6.7e-55
• PF00702: Hydrolase
  • amino acids 14 to 194 (181 residues), 79.1 bits, E=6.2e-26
• TIGR01493: HAD hydrolase, family IA, variant 2
  • amino acids 15 to 191 (177 residues), 52.2 bits, E=8.5e-18
• PF13419: HAD_2
  • amino acids 16 to 199 (184 residues), 68.4 bits, E=8.8e-23

Best Hits

KEGG orthology group: K01560, 2-haloacid dehalogenase [EC: 3.8.1.2] (inferred from 44% identity to mrd:Mrad2831_2564)

Predicted SEED Role

No annotation

MetaCyc Pathways

• 2-chloroacrylate degradation I (1/3 steps found)

KEGG Metabolic Maps

• 1,2-Dichloroethane degradation
• gamma-Hexachlorocyclohexane degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.8.1.2

Sequence Analysis Tools

See A0A1X9YVE1 at UniProt or InterPro

Protein Sequence (232 amino acids)

>CA264_15630 haloacid dehalogenase, type II (Pontibacter actiniarum KMM 6156, DSM 19842)
MPDSMKSPNKRPAVLLFDVNETLLDLSDMQQAVNKAFDNELAFKLWFAYLLEYALVENST
GKYHDFSKVGQAAMQMITKALGKDIPEEKQQELVRMVNDTPPHPDVVPGLEKLQAAGFRL
ATLTNSPAASGIPHLEQVGLKHFFEETFSVDSVQKFKPHRSPYQHAADQLGVEMEEVMMV
AAHGWDMAGALRAGMRAAFISRPGQALYPLAPEPELTAPTLLALAQQLERLA