Protein Info for CA264_15540 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 transmembrane" amino acids 13 to 36 (24 residues), see Phobius details amino acids 48 to 69 (22 residues), see Phobius details amino acids 89 to 105 (17 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 160 to 181 (22 residues), see Phobius details amino acids 193 to 212 (20 residues), see Phobius details amino acids 218 to 237 (20 residues), see Phobius details PF03741: TerC" amino acids 14 to 209 (196 residues), 158.5 bits, see alignment E=7.9e-51

Best Hits

Swiss-Prot: 50% identical to Y056_HAEIN: UPF0053 protein HI_0056 (HI_0056) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: None (inferred from 60% identity to gfo:GFO_0004)

Predicted SEED Role

"Integral membrane protein TerC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YV31 at UniProt or InterPro

Protein Sequence (260 amino acids)

>CA264_15540 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MEIFANPDTWLSLLTLTFMEVVLGIDNIVFISIVVGRLPKEQQAKGRTIGLALALVFRII
LLLFISWIVGASAPLFSINLPFTETDFAVSWRDIILFGGGLFLLAKSTTEIHNKLEGEEE
EHGGGKVQTTMSKILVQIVLIDIVFSFDSILTAVGLAQEVIVMIIAVILAMGIMLVFAKY
VSDFVNKHPTVKMLALSFLILIGFMLVVEALHQHIPKGYIYFAMFFSLVVEMLNLQLRKR
TTPVHLRQNEVLDAEENEIV