Protein Info for CA264_15465 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: glycerol acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 transmembrane" amino acids 306 to 327 (22 residues), see Phobius details amino acids 347 to 372 (26 residues), see Phobius details amino acids 382 to 403 (22 residues), see Phobius details PF01553: Acyltransferase" amino acids 20 to 159 (140 residues), 80.4 bits, see alignment E=5.5e-27

Best Hits

Predicted SEED Role

"1-acyl-sn-glycerol-3-phosphate acyltransferase (EC 2.3.1.51)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Phosphate metabolism (EC 2.3.1.51)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.51

Use Curated BLAST to search for 2.3.1.51

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YUZ6 at UniProt or InterPro

Protein Sequence (451 amino acids)

>CA264_15465 glycerol acyltransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MLYAILKMIYRLGLRVFFRRLEVRNRHLIPDQGPLLVVSNHPNTFMDPIVTASLLRQPVF
FIAKSTVFGSGFQNWMLRQMHLIPIHRREDNPDQPVSNEEAFTASFRALRQGKTLLIFPE
GNSYNQRRLRKVKTGTARIALGAEAAAAATLGVRILPVGLNYSDPTRFRSDVFVNVGEPI
QVAAYASAYEQDGQAAAQALTDTIRQRLESLIIHTPTDEEDALARQVEALYKDQLAAAIP
IPAPEHIRDFLLTKAIVRGINYFSQTAPEQVAALKHDIHQYTLQLRRLRLHDALLGKGRS
TVLGRSAFGLFLLLLGLPLYLYGLLHNYLPYIIPSRVARAATKEEEWYAPIMLTVGIFSF
PLFYALEAWLLWEWLQPPFYKLMLYLLSLPLSGFFALGYWNTLLHTQAHWLLLRLFFRRR
NVVEELRKQRQCIIVQLEQARQAYMAQQEGE