Protein Info for CA264_15415 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: 1-aminocyclopropane-1-carboxylate deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00291: PALP
  • amino acids 6 to 285 (280 residues), 92.2 bits, E=2e-30

Best Hits

KEGG orthology group: None (inferred from 54% identity to lan:Lacal_1645)

Predicted SEED Role

"1-aminocyclopropane-1-carboxylate deaminase (EC 3.5.99.7)" (EC 3.5.99.7)

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (16/17 steps found)
• superpathway of L-isoleucine biosynthesis I (11/13 steps found)
• L-isoleucine biosynthesis I (from threonine) (6/7 steps found)
• L-methionine degradation II (3/3 steps found)
• L-threonine degradation I (2/6 steps found)
• superpathway of L-threonine metabolism (10/18 steps found)
• hypoglycin biosynthesis (3/14 steps found)

KEGG Metabolic Maps

• Propanoate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.99.7

Sequence Analysis Tools

See A0A1X9YUY3 at UniProt or InterPro

Protein Sequence (301 amino acids)

>CA264_15415 1-aminocyclopropane-1-carboxylate deaminase (Pontibacter actiniarum KMM 6156, DSM 19842)
MMEEAPLQKLEAPLWQEQGVALWVKREDLLHPHISGNKWRKLKYNLQEARQQDHHTLLTF
GGAYSNHIAATAAAGKAYGFRSIGIIRGEEHLPLNPTLALATSCGMQLHYISREQYRLKS
EPGFLQELRAQFGQVYVLPEGGTNLLAVKGCAEIVPDIDVDFSHICCAMGTGGTFAGIVA
GLTGEKEALGFPALKGGAFLRQEVEELVLAYSGQRYHNWQLATEYHFGGYAKVKPELLAF
MAQFKQEHGIPLEPVYTGKMMYGLFDLVRKGYFPRGSRVVAVHTGGLQGNAGFKERLGVE
V