Protein Info for CA264_15375 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: EamA family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 26 to 45 (20 residues), see Phobius details amino acids 57 to 75 (19 residues), see Phobius details amino acids 81 to 101 (21 residues), see Phobius details amino acids 108 to 127 (20 residues), see Phobius details amino acids 134 to 153 (20 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details amino acids 193 to 210 (18 residues), see Phobius details amino acids 222 to 241 (20 residues), see Phobius details amino acids 247 to 266 (20 residues), see Phobius details PF00892: EamA" amino acids 1 to 124 (124 residues), 58.2 bits, see alignment E=5e-20 amino acids 136 to 263 (128 residues), 44.8 bits, see alignment E=7.3e-16

Best Hits

KEGG orthology group: None (inferred from 54% identity to mtt:Ftrac_3553)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YUV5 at UniProt or InterPro

Protein Sequence (289 amino acids)

>CA264_15375 EamA family transporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MLLSTFFFSLMQVCVKWVPHIPAEEIIVFRSLISLVISLAFLRRAGVSVWGNNRKWLFAR
GGFGAVALILFFNVLQNIPLATAATLQYLSPIFTAILGIFIVKERVRLWQWVFFLVSFAG
VLVIEGVETNVEGLYLWLGVVSAFFTGVAYSIVRKLNVQEHPLVIIFYFPLVTLPVVGGY
TLFNWVQPEGWDWAMLLLVGLFTQLGQYYMTLSYQHEEISKVANLTYISIVYALLFGFFF
FGELLNTWTYVGMALVLLGVILNVQYKNKISKKATLAAESGSTEVETEV